Lineage for d1q40c_ (1q40 C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020063Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 1020064Protein mRNA transport regulator MTR2 [89849] (2 species)
    similar to p15; forms complex with MEX67 similar to the TAP-p15 complex
  7. 1020067Species Yeast (Candida albicans) [TaxId:5476] [102809] (2 PDB entries)
  8. 1020069Domain d1q40c_: 1q40 C: [95772]
    Other proteins in same PDB: d1q40b_, d1q40d_
    complexed with gol

Details for d1q40c_

PDB Entry: 1q40 (more details), 1.95 Å

PDB Description: Crystal structure of the C. albicans Mtr2-Mex67 M domain complex
PDB Compounds: (C:) mRNA transport regulator mtr2

SCOPe Domain Sequences for d1q40c_:

Sequence, based on SEQRES records: (download)

>d1q40c_ d.17.4.2 (C:) mRNA transport regulator MTR2 {Yeast (Candida albicans) [TaxId: 5476]}
qdptqqlepflkrflasldllytqptsqpfpnvesyatqlgsnlkrssaiivngqpiips
pqedcklqfqkkwlqtplsshqltsydghlipgtgtfvvhfsakvrfdqsgrnrlgesad
lfqennsivsktnqrpiwgswfgvdvnlvvdenvmqdgeiinsmdyrftyvpnd

Sequence, based on observed residues (ATOM records): (download)

>d1q40c_ d.17.4.2 (C:) mRNA transport regulator MTR2 {Yeast (Candida albicans) [TaxId: 5476]}
qdptqqlepflkrflasldllytqptsqpfpnvesyatqlgsnlkrssaiivngqpiips
pqedcklqfqkkwlqtplsshqltsydghlipgtgtfvvhfsakvrfdqsgrnrlgesad
lfqqrpiwgswfgvdvnlvvdenvmqdgeiinsmdyrftyvpnd

SCOPe Domain Coordinates for d1q40c_:

Click to download the PDB-style file with coordinates for d1q40c_.
(The format of our PDB-style files is described here.)

Timeline for d1q40c_: