SCOP 1.67: Domain d1q40c_: 1q40 C:

Lineage for d1q40c_ (1q40 C:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (10 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (5 proteins)

6. Protein mRNA transport regulator MTR2 [89849] (2 species)
   similar to p15; forms complex with MEX67 similar to the TAP-p15 complex

7. Species Yeast (Candida albicans) [TaxId:5476] [102809] (2 PDB entries)

8. Domain d1q40c_: 1q40 C: [95772]
   Other proteins in same PDB: d1q40b_, d1q40d_
   complexed with gol

Details for d1q40c_

PDB Entry: 1q40, 1.95 Å

PDB Description: Crystal structure of the C. albicans Mtr2-Mex67 M domain complex

SCOP Domain Sequences for d1q40c_:

Sequence, based on SEQRES records:

>d1q40c_ d.17.4.2 (C:) mRNA transport regulator MTR2 {Yeast (Candida albicans)}
qdptqqlepflkrflasldllytqptsqpfpnvesyatqlgsnlkrssaiivngqpiips
pqedcklqfqkkwlqtplsshqltsydghlipgtgtfvvhfsakvrfdqsgrnrlgesad
lfqennsivsktnqrpiwgswfgvdvnlvvdenvmqdgeiinsmdyrftyvpnd

Sequence, based on observed residues (ATOM records):

>d1q40c_ d.17.4.2 (C:) mRNA transport regulator MTR2 {Yeast (Candida albicans)}
qdptqqlepflkrflasldllytqptsqpfpnvesyatqlgsnlkrssaiivngqpiips
pqedcklqfqkkwlqtplsshqltsydghlipgtgtfvvhfsakvrfdqsgrnrlgesad
lfqqrpiwgswfgvdvnlvvdenvmqdgeiinsmdyrftyvpnd

Timeline for d1q40c_:

• d1q40c_ is new in SCOP 1.67
  
• d1q40c_ appears in SCOP 1.69
  
• d1q40c_ appears in the current release, SCOPe 2.08