Lineage for d1q40a_ (1q40 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408884Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 409086Superfamily d.17.4: NTF2-like [54427] (10 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 409110Family d.17.4.2: NTF2-like [54431] (5 proteins)
  6. 409111Protein mRNA transport regulator MTR2 [89849] (2 species)
    similar to p15; forms complex with MEX67 similar to the TAP-p15 complex
  7. 409114Species Yeast (Candida albicans) [TaxId:5476] [102809] (2 PDB entries)
  8. 409115Domain d1q40a_: 1q40 A: [95770]
    Other proteins in same PDB: d1q40b_, d1q40d_

Details for d1q40a_

PDB Entry: 1q40 (more details), 1.95 Å

PDB Description: Crystal structure of the C. albicans Mtr2-Mex67 M domain complex

SCOP Domain Sequences for d1q40a_:

Sequence, based on SEQRES records: (download)

>d1q40a_ d.17.4.2 (A:) mRNA transport regulator MTR2 {Yeast (Candida albicans)}
qdptqqlepflkrflasldllytqptsqpfpnvesyatqlgsnlkrssaiivngqpiips
pqedcklqfqkkwlqtplsshqltsydghlipgtgtfvvhfsakvrfdqsgrnrlgesad
lfqennsivsktnqrpiwgswfgvdvnlvvdenvmqdgeiinsmdyrftyvpnd

Sequence, based on observed residues (ATOM records): (download)

>d1q40a_ d.17.4.2 (A:) mRNA transport regulator MTR2 {Yeast (Candida albicans)}
qdptqqlepflkrflasldllytqsqpfpnvesyatqlgsnlkrssaiivngqpiipspq
edcklqfqkkwlqtplsshqltsydghlipgtgtfvvhfsakvrfdqsgrnrlgesadlf
qennqrpiwgswfgvdvnlvvdenvmqdgeiinsmdyrftyvpnd

SCOP Domain Coordinates for d1q40a_:

Click to download the PDB-style file with coordinates for d1q40a_.
(The format of our PDB-style files is described here.)

Timeline for d1q40a_: