![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species) CMGC group; GSK3 subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69824] (14 PDB entries) |
![]() | Domain d1q3wb_: 1q3w B: [95769] complexed with atu |
PDB Entry: 1q3w (more details), 2.3 Å
SCOP Domain Sequences for d1q3wb_:
Sequence, based on SEQRES records: (download)
>d1q3wb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar
>d1q3wb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk nrelqimrkldhcnivrlryffyssgdevylnlvldyvpetvyrvarhysrakqtlpviy vklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyi csryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtpt reqiremnpkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffde lrdpnvklpngrdtpalfnfttqelssnpplatilipphar
Timeline for d1q3wb_: