Lineage for d1q3wb_ (1q3w B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543788Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (2 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 2543789Species Human (Homo sapiens) [TaxId:9606] [69824] (51 PDB entries)
    Uniprot P49841 35-383 ! Uniprot P49841 35-384
  8. 2543813Domain d1q3wb_: 1q3w B: [95769]
    complexed with atu

Details for d1q3wb_

PDB Entry: 1q3w (more details), 2.3 Å

PDB Description: GSK-3 Beta complexed with Alsterpaullone
PDB Compounds: (B:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d1q3wb_:

Sequence, based on SEQRES records: (download)

>d1q3wb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar

Sequence, based on observed residues (ATOM records): (download)

>d1q3wb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssgdevylnlvldyvpetvyrvarhysrakqtlpviy
vklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyi
csryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtpt
reqiremnpkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffde
lrdpnvklpngrdtpalfnfttqelssnpplatilipphar

SCOPe Domain Coordinates for d1q3wb_:

Click to download the PDB-style file with coordinates for d1q3wb_.
(The format of our PDB-style files is described here.)

Timeline for d1q3wb_: