| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) ![]() |
| Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins) |
| Protein Cre recombinase [56355] (1 species) |
| Species Bacteriophage P1 [TaxId:10678] [56356] (18 PDB entries) |
| Domain d1q3vf2: 1q3v F:130-341 [95767] Other proteins in same PDB: d1q3va1, d1q3vb1, d1q3ve1, d1q3vf1 complexed with a3p, iod, mg, ump |
PDB Entry: 1q3v (more details), 2.91 Å
SCOP Domain Sequences for d1q3vf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3vf2 d.163.1.1 (F:130-341) Cre recombinase {Bacteriophage P1}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled
Timeline for d1q3vf2: