| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) ![]() |
| Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins) |
| Protein Cre recombinase [47825] (1 species) |
| Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries) Uniprot P06956 20-341 |
| Domain d1q3uf1: 1q3u F:20-129 [95758] Other proteins in same PDB: d1q3ua2, d1q3ub2, d1q3ue2, d1q3uf2 protein/DNA complex; complexed with iod, mg |
PDB Entry: 1q3u (more details), 2.9 Å
SCOPe Domain Sequences for d1q3uf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3uf1 a.60.9.1 (F:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage
Timeline for d1q3uf1: