Lineage for d1q3ue2 (1q3u E:130-341)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513818Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 513819Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 513820Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)
  6. 513821Protein Cre recombinase [56355] (1 species)
  7. 513822Species Bacteriophage P1 [TaxId:10678] [56356] (16 PDB entries)
  8. 513838Domain d1q3ue2: 1q3u E:130-341 [95757]
    Other proteins in same PDB: d1q3ua1, d1q3ub1, d1q3ue1, d1q3uf1

Details for d1q3ue2

PDB Entry: 1q3u (more details), 2.9 Å

PDB Description: Crystal structure of a wild-type Cre recombinase-loxP synapse: pre-cleavage complex

SCOP Domain Sequences for d1q3ue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3ue2 d.163.1.1 (E:130-341) Cre recombinase {Bacteriophage P1}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

SCOP Domain Coordinates for d1q3ue2:

Click to download the PDB-style file with coordinates for d1q3ue2.
(The format of our PDB-style files is described here.)

Timeline for d1q3ue2: