Lineage for d1q3sb2 (1q3s B:217-369)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389637Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 389744Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 389875Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)
  6. 389876Protein Thermosome, A-domain [52035] (4 species)
  7. 389877Species Archaeon Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102202] (4 PDB entries)
  8. 389891Domain d1q3sb2: 1q3s B:217-369 [95732]
    Other proteins in same PDB: d1q3sa1, d1q3sa3, d1q3sb1, d1q3sb3, d1q3sc1, d1q3sc3, d1q3sd1, d1q3sd3, d1q3se1, d1q3se3, d1q3sf1, d1q3sf3, d1q3sg1, d1q3sg3, d1q3sh1, d1q3sh3

Details for d1q3sb2

PDB Entry: 1q3s (more details), 3 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (formiii crystal complexed with adp)

SCOP Domain Sequences for d1q3sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3sb2 c.8.5.2 (B:217-369) Thermosome, A-domain {Archaeon Thermococcus sp. ks-1, alpha chain}
rgvvidkevvhprmpkrvenakialinealevkktetdakinitspdqlmsfleqeekml
kdmvdhiaqtganvvfvqkgiddlaqhylakygimavrrvkksdmeklakatgakivtnv
kdltpedlgyaevveerklagenmifvegcknp

SCOP Domain Coordinates for d1q3sb2:

Click to download the PDB-style file with coordinates for d1q3sb2.
(The format of our PDB-style files is described here.)

Timeline for d1q3sb2: