Lineage for d1q3rd1 (1q3r D:9-145,D:406-526)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749675Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 1749676Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 1749860Family a.129.1.2: Group II chaperonin (CCT, TRIC), ATPase domain [48596] (1 protein)
  6. 1749861Protein Thermosome, E domain [48597] (3 species)
  7. 1749862Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [101457] (4 PDB entries)
  8. 1749874Domain d1q3rd1: 1q3r D:9-145,D:406-526 [95725]
    Other proteins in same PDB: d1q3ra2, d1q3ra3, d1q3rb2, d1q3rb3, d1q3rc2, d1q3rc3, d1q3rd2, d1q3rd3
    complexed with so4; mutant

Details for d1q3rd1

PDB Entry: 1q3r (more details), 2.9 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (nucleotide-free form of single mutant)
PDB Compounds: (D:) Thermosome alpha subunit

SCOPe Domain Sequences for d1q3rd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3rd1 a.129.1.2 (D:9-145,D:406-526) Thermosome, E domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}
vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndgati
ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
alaaekaqeildeiairXavlpaggapeielairldeyakqvggkealaienfadalkii
pktlaenagldtvemlvkvisehknrglgigidvfegkpadmlekgiieplrvkkqaiks
aseaaimilriddviaaka

SCOPe Domain Coordinates for d1q3rd1:

Click to download the PDB-style file with coordinates for d1q3rd1.
(The format of our PDB-style files is described here.)

Timeline for d1q3rd1: