SCOPe 2.08: Domain d1q3rb3: 1q3r B:146-216,B:370-405

Lineage for d1q3rb3 (1q3r B:146-216,B:370-405)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
   3-helical bundle packed against 3-stranded mixed beta-sheet

4. Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families)

5. Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein)

6. Protein Thermosome, I domain [54854] (3 species)

7. Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102951] (4 PDB entries)

8. Domain d1q3rb3: 1q3r B:146-216,B:370-405 [95721]
   Other proteins in same PDB: d1q3ra1, d1q3ra2, d1q3rb1, d1q3rb2, d1q3rc1, d1q3rc2, d1q3rd1, d1q3rd2
   complexed with so4; mutant

Details for d1q3rb3

PDB Entry: 1q3r, 2.9 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (nucleotide-free form of single mutant)

PDB Compounds: (B:) Thermosome alpha subunit

SCOPe Domain Sequences for d1q3rb3:

Sequence; same for both SEQRES and ATOM records:

>d1q3rb3 d.56.1.2 (B:146-216,B:370-405) Thermosome, I domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}
vdpddeetllkiaatsitgknaeshkellaklaveavkqvaekkdgkyvvdldnikfekk
agegveeselvXkavtilirggtehvideveraledavkvvkdvmedg

Timeline for d1q3rb3:

• d1q3rb3 first appeared in SCOP 1.67
  
• d1q3rb3 appears in SCOPe 2.07