Lineage for d1q3rb3 (1q3r B:146-216,B:370-405)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172066Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 2172067Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 2172251Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein)
  6. 2172252Protein Thermosome, I domain [54854] (3 species)
  7. 2172253Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102951] (4 PDB entries)
  8. 2172263Domain d1q3rb3: 1q3r B:146-216,B:370-405 [95721]
    Other proteins in same PDB: d1q3ra1, d1q3ra2, d1q3rb1, d1q3rb2, d1q3rc1, d1q3rc2, d1q3rd1, d1q3rd2
    complexed with so4; mutant

Details for d1q3rb3

PDB Entry: 1q3r (more details), 2.9 Å

PDB Description: Crystal structure of the chaperonin from Thermococcus strain KS-1 (nucleotide-free form of single mutant)
PDB Compounds: (B:) Thermosome alpha subunit

SCOPe Domain Sequences for d1q3rb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3rb3 d.56.1.2 (B:146-216,B:370-405) Thermosome, I domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}
vdpddeetllkiaatsitgknaeshkellaklaveavkqvaekkdgkyvvdldnikfekk
agegveeselvXkavtilirggtehvideveraledavkvvkdvmedg

SCOPe Domain Coordinates for d1q3rb3:

Click to download the PDB-style file with coordinates for d1q3rb3.
(The format of our PDB-style files is described here.)

Timeline for d1q3rb3: