SCOPe 2.05: Domain d1q3pa_: 1q3p A:

Lineage for d1q3pa_ (1q3p A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Shank1, PDZ domain [101733] (1 species)
   SH3 and multiple ankyrin repeat domains protein 1

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101734] (5 PDB entries)

8. Domain d1q3pa_: 1q3p A: [95702]

Details for d1q3pa_

PDB Entry: 1q3p, 2.25 Å

PDB Description: Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization

PDB Compounds: (A:) Shank1

SCOPe Domain Sequences for d1q3pa_:

Sequence, based on SEQRES records:

>d1q3pa_ b.36.1.1 (A:) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawrag
lrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

Sequence, based on observed residues (ATOM records):

>d1q3pa_ b.36.1.1 (A:) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dyiikektvllqkkdsegfgfvlrgaieeftptpafpalqylesvdeggvawraglrmgd
flievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

Timeline for d1q3pa_:

• d1q3pa_ first appeared in SCOP 1.67
  
• d1q3pa_ appears in SCOPe 2.04
  
• d1q3pa_ appears in SCOPe 2.06
  
• d1q3pa_ appears in the current release, SCOPe 2.08