Lineage for d1q3ob_ (1q3o B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2379872Protein Shank1, PDZ domain [101733] (1 species)
    SH3 and multiple ankyrin repeat domains protein 1
  7. 2379873Species Norway rat (Rattus norvegicus) [TaxId:10116] [101734] (5 PDB entries)
  8. 2379875Domain d1q3ob_: 1q3o B: [95701]
    complexed with br

Details for d1q3ob_

PDB Entry: 1q3o (more details), 1.8 Å

PDB Description: Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization
PDB Compounds: (B:) Shank1

SCOPe Domain Sequences for d1q3ob_:

Sequence, based on SEQRES records: (download)

>d1q3ob_ b.36.1.1 (B:) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawr
aglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdm

Sequence, based on observed residues (ATOM records): (download)

>d1q3ob_ b.36.1.1 (B:) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsdyiikektvllqkkdsegfgfvlrgaieeftptpafpalqylesvdeggvawraglrm
gdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdm

SCOPe Domain Coordinates for d1q3ob_:

Click to download the PDB-style file with coordinates for d1q3ob_.
(The format of our PDB-style files is described here.)

Timeline for d1q3ob_: