Lineage for d1q3ma_ (1q3m A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064964Fold g.32: GLA-domain [57629] (1 superfamily)
    Calcium ion-bound
  4. 1064965Superfamily g.32.1: GLA-domain [57630] (2 families) (S)
    gamma-carboxy-glutamic acid-rich domain
  5. 1064966Family g.32.1.1: GLA-domain [57631] (6 proteins)
  6. 1065008Protein Osteocalcin [103594] (2 species)
  7. 1065009Species Cow (Bos taurus) [TaxId:9913] [103595] (1 PDB entry)
  8. 1065010Domain d1q3ma_: 1q3m A: [95699]

Details for d1q3ma_

PDB Entry: 1q3m (more details)

PDB Description: 1h nmr structure bundle of bovine ca2+-osteocalcin
PDB Compounds: (A:) Osteocalcin

SCOPe Domain Sequences for d1q3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3ma_ g.32.1.1 (A:) Osteocalcin {Cow (Bos taurus) [TaxId: 9913]}
lepkrevcelnpdcdeladhigfqeayrrfygpv

SCOPe Domain Coordinates for d1q3ma_:

Click to download the PDB-style file with coordinates for d1q3ma_.
(The format of our PDB-style files is described here.)

Timeline for d1q3ma_: