Lineage for d1q3kd_ (1q3k D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885804Fold c.125: Creatininase [102214] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1885805Superfamily c.125.1: Creatininase [102215] (1 family) (S)
    automatically mapped to Pfam PF02633
  5. 1885806Family c.125.1.1: Creatininase [102216] (2 proteins)
  6. 1885807Protein Creatininase [102217] (1 species)
  7. 1885808Species Pseudomonas putida [TaxId:303] [102218] (12 PDB entries)
  8. 1885842Domain d1q3kd_: 1q3k D: [95696]
    complexed with gol, zn

Details for d1q3kd_

PDB Entry: 1q3k (more details), 2.1 Å

PDB Description: crystal structure of creatinine amidohydrolase (creatininase)
PDB Compounds: (D:) creatininase

SCOPe Domain Sequences for d1q3kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3kd_ c.125.1.1 (D:) Creatininase {Pseudomonas putida [TaxId: 303]}
sksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavcqrvaerig
alvlpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgvrrlvlmnghy
ensmfivegidlalrelryagihdfkvvvlsywdfvkdpaviqrlypegflgwdiehggv
fetslmlalypdlvdlervvdhppatfppydvfpvdpartpapgtlssaktasrekgeli
levcvqgiadaigqefppt

SCOPe Domain Coordinates for d1q3kd_:

Click to download the PDB-style file with coordinates for d1q3kd_.
(The format of our PDB-style files is described here.)

Timeline for d1q3kd_: