Lineage for d1q3ja_ (1q3j A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030262Superfamily g.3.4: Gurmarin-like [57048] (2 families) (S)
  5. 3030269Family g.3.4.2: Antifungal peptide [57052] (2 proteins)
    automatically mapped to Pfam PF11410
  6. 3030270Protein Antifungal peptide Alo3 [103529] (1 species)
  7. 3030271Species Acrocinus longimanus [TaxId:227548] [103530] (1 PDB entry)
  8. 3030272Domain d1q3ja_: 1q3j A: [95692]

Details for d1q3ja_

PDB Entry: 1q3j (more details)

PDB Description: Solution structure of ALO3: a new knottin-type antifungal peptide from the insect Acrocinus longimanus
PDB Compounds: (A:) alo3

SCOPe Domain Sequences for d1q3ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3ja_ g.3.4.2 (A:) Antifungal peptide Alo3 {Acrocinus longimanus [TaxId: 227548]}
cikngngcqpngsqgnccsgychkqpgwvagycrrk

SCOPe Domain Coordinates for d1q3ja_:

Click to download the PDB-style file with coordinates for d1q3ja_.
(The format of our PDB-style files is described here.)

Timeline for d1q3ja_: