Lineage for d1q3hb_ (1q3h B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112785Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 protein domains)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2112801Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2112821Species Mouse (Mus musculus) [TaxId:10090] [102379] (9 PDB entries)
    Uniprot P26361 390-670
  8. 2112839Domain d1q3hb_: 1q3h B: [95689]
    Other proteins in same PDB: d1q3hc2
    complexed with acy, anp, mg

Details for d1q3hb_

PDB Entry: 1q3h (more details), 2.5 Å

PDB Description: mouse CFTR NBD1 with AMP.PNP
PDB Compounds: (B:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d1q3hb_:

Sequence, based on SEQRES records: (download)

>d1q3hb_ c.37.1.12 (B:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
ttgiimenvtafweegfgellekvqqsngdrkhssdennvsfshlclvgnpvlkninlni
ekgemlaitgstgsgktsllmlilgeleasegiikhsgrvsfcsqfswimpgtikeniif
gvsydeyryksvvkacqlqqditkfaeqdntvlgeggvtlsggqrarislaravykdadl
ylldspfgyldvfteeqvfescvcklmanktrilvtskmehlrkadkililhqgssyfyg
tfselqslrpdfssklmgydtfdqfteerrssiltetlrrfs

Sequence, based on observed residues (ATOM records): (download)

>d1q3hb_ c.37.1.12 (B:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
ttgiimenvtafweegfgellekvvsfshlclvgnpvlkninlniekgemlaitgstgsg
ktsllmlilgeleasegiikhsgrvsfcsqfswimpgtikeniifgvsydeyryksvvka
cqlqqditkfaeqdntvlgeggvtlsggqrarislaravykdadlylldspfgyldvfte
eqvfescvcklmanktrilvtskmehlrkadkililhqgssyfygtfselqslrpdfssk
lmgydtfdqfteerrssiltetlrrfs

SCOPe Domain Coordinates for d1q3hb_:

Click to download the PDB-style file with coordinates for d1q3hb_.
(The format of our PDB-style files is described here.)

Timeline for d1q3hb_: