Lineage for d1q3gy_ (1q3g Y:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413649Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 413659Superfamily d.68.2: EPT/RTPC-like [55205] (2 families) (S)
  5. 413669Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (2 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
  6. 413690Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (2 species)
  7. 413691Species Enterobacter cloacae [TaxId:550] [55212] (6 PDB entries)
  8. 413714Domain d1q3gy_: 1q3g Y: [95686]

Details for d1q3gy_

PDB Entry: 1q3g (more details), 2.65 Å

PDB Description: mura (asp305ala) liganded with tetrahedral reaction intermediate

SCOP Domain Sequences for d1q3gy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3gy_ d.68.2.2 (Y:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkverngsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
afptamqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

SCOP Domain Coordinates for d1q3gy_:

Click to download the PDB-style file with coordinates for d1q3gy_.
(The format of our PDB-style files is described here.)

Timeline for d1q3gy_: