Lineage for d1q3gj_ (1q3g J:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 505944Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 505954Superfamily d.68.2: EPT/RTPC-like [55205] (2 families) (S)
  5. 505964Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (2 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
  6. 505985Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (2 species)
  7. 505986Species Enterobacter cloacae [TaxId:550] [55212] (6 PDB entries)
  8. 506004Domain d1q3gj_: 1q3g J: [95681]

Details for d1q3gj_

PDB Entry: 1q3g (more details), 2.65 Å

PDB Description: mura (asp305ala) liganded with tetrahedral reaction intermediate

SCOP Domain Sequences for d1q3gj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3gj_ d.68.2.2 (J:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkverngsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
afptamqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

SCOP Domain Coordinates for d1q3gj_:

Click to download the PDB-style file with coordinates for d1q3gj_.
(The format of our PDB-style files is described here.)

Timeline for d1q3gj_: