Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.18: DNA glycosylase [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: DNA glycosylase [52141] (3 families) |
Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) |
Protein Uracil-DNA glycosylase [52143] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [52144] (8 PDB entries) |
Domain d1q3fa_: 1q3f A: [95671] complexed with nri, po4, ura |
PDB Entry: 1q3f (more details), 1.9 Å
SCOP Domain Sequences for d1q3fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3fa_ c.18.1.1 (A:) Uracil-DNA glycosylase {Human (Homo sapiens)} meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
Timeline for d1q3fa_: