Lineage for d1q3fa_ (1q3f A:)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.18: DNA glycosylase [52140] (1 superfamily)
3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134Superfamily c.18.1: DNA glycosylase [52141] (3 families) 
Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) Protein Uracil-DNA glycosylase [52143] (4 species) 
Species Human (Homo sapiens) [TaxId:9606] [52144] (8 PDB entries) 
Domain d1q3fa_: 1q3f A: [95671]
complexed with nri, po4, ura
Details for d1q3fa_
PDB Entry: 1q3f (more details), 1.9 Å
PDB Description: uracil dna glycosylase bound to a cationic 1-aza-2'-deoxyribose- containing dna
SCOP Domain Sequences for d1q3fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3fa_ c.18.1.1 (A:) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
SCOP Domain Coordinates for d1q3fa_:
Click to download the PDB-style file with coordinates for d1q3fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q3fa_:
- d1q3fa_ is new in SCOP 1.67
- d1q3fa_ appears in SCOP 1.69
- d1q3fa_ appears in the current release, SCOPe 2.08, called d1q3fa1
View in 3D