Lineage for d1q3ea_ (1q3e A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381159Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 381481Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 381487Family b.82.3.2: cAMP-binding domain [51210] (5 proteins)
  6. 381516Protein HCN pacemaker channel [101993] (1 species)
    potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel
  7. 381517Species Mouse (Mus musculus) [TaxId:10090] [101994] (3 PDB entries)
  8. 381518Domain d1q3ea_: 1q3e A: [95669]

Details for d1q3ea_

PDB Entry: 1q3e (more details), 1.9 Å

PDB Description: HCN2J 443-645 in the presence of cGMP

SCOP Domain Sequences for d1q3ea_:

Sequence, based on SEQRES records: (download)

>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus)}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldr

Sequence, based on observed residues (ATOM records): (download)

>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus)}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrr
afetvaidrldr

SCOP Domain Coordinates for d1q3ea_:

Click to download the PDB-style file with coordinates for d1q3ea_.
(The format of our PDB-style files is described here.)

Timeline for d1q3ea_: