SCOP 1.69: Domain d1q3ac_: 1q3a C:

Lineage for d1q3ac_ (1q3a C:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Stromelysin-2 (MMP-10) [103128] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103129] (1 PDB entry)

8. Domain d1q3ac_: 1q3a C: [95666]

Details for d1q3ac_

PDB Entry: 1q3a, 2.1 Å

PDB Description: crystal structure of the catalytic domain of human matrix metalloproteinase 10

SCOP Domain Sequences for d1q3ac_:

Sequence, based on SEQRES records:

>d1q3ac_ d.92.1.11 (C:) Stromelysin-2 (MMP-10) {Human (Homo sapiens)}
pkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfavk
ehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslgl
fhsantealmyplynsftelaqfrlsqddvngiqslyg

Sequence, based on observed residues (ATOM records):

>d1q3ac_ d.92.1.11 (C:) Stromelysin-2 (MMP-10) {Human (Homo sapiens)}
pkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfavk
ehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslgl
fhsantealmyplynslaqfrlsqddvngiqslyg

Timeline for d1q3ac_:

• d1q3ac_ first appeared in SCOP 1.67
  
• d1q3ac_ appears in SCOP 1.71
  
• d1q3ac_ appears in the current release, SCOPe 2.08