Lineage for d1q3ac_ (1q3a C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964628Protein Stromelysin-2 (MMP-10) [103128] (1 species)
  7. 2964629Species Human (Homo sapiens) [TaxId:9606] [103129] (1 PDB entry)
  8. 2964632Domain d1q3ac_: 1q3a C: [95666]
    complexed with ca, ngh, zn

Details for d1q3ac_

PDB Entry: 1q3a (more details), 2.1 Å

PDB Description: crystal structure of the catalytic domain of human matrix metalloproteinase 10
PDB Compounds: (C:) Stromelysin-2

SCOPe Domain Sequences for d1q3ac_:

Sequence, based on SEQRES records: (download)

>d1q3ac_ d.92.1.11 (C:) Stromelysin-2 (MMP-10) {Human (Homo sapiens) [TaxId: 9606]}
pkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfavk
ehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslgl
fhsantealmyplynsftelaqfrlsqddvngiqslyg

Sequence, based on observed residues (ATOM records): (download)

>d1q3ac_ d.92.1.11 (C:) Stromelysin-2 (MMP-10) {Human (Homo sapiens) [TaxId: 9606]}
pkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfavk
ehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslgl
fhsantealmyplynslaqfrlsqddvngiqslyg

SCOPe Domain Coordinates for d1q3ac_:

Click to download the PDB-style file with coordinates for d1q3ac_.
(The format of our PDB-style files is described here.)

Timeline for d1q3ac_: