Lineage for d1q3ab_ (1q3a B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507855Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 507856Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 508071Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 508222Protein Stromelysin-2 (MMP-10) [103128] (1 species)
  7. 508223Species Human (Homo sapiens) [TaxId:9606] [103129] (1 PDB entry)
  8. 508225Domain d1q3ab_: 1q3a B: [95665]

Details for d1q3ab_

PDB Entry: 1q3a (more details), 2.1 Å

PDB Description: crystal structure of the catalytic domain of human matrix metalloproteinase 10

SCOP Domain Sequences for d1q3ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3ab_ d.92.1.11 (B:) Stromelysin-2 (MMP-10) {Human (Homo sapiens)}
gmpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfa
vkehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghsl
glfhsantealmyplynsftelaqfrlsqddvngiqslyg

SCOP Domain Coordinates for d1q3ab_:

Click to download the PDB-style file with coordinates for d1q3ab_.
(The format of our PDB-style files is described here.)

Timeline for d1q3ab_: