Lineage for d1q3aa_ (1q3a A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2571243Protein Stromelysin-2 (MMP-10) [103128] (1 species)
  7. 2571244Species Human (Homo sapiens) [TaxId:9606] [103129] (1 PDB entry)
  8. 2571245Domain d1q3aa_: 1q3a A: [95664]
    complexed with ca, ngh, zn

Details for d1q3aa_

PDB Entry: 1q3a (more details), 2.1 Å

PDB Description: crystal structure of the catalytic domain of human matrix metalloproteinase 10
PDB Compounds: (A:) Stromelysin-2

SCOPe Domain Sequences for d1q3aa_:

Sequence, based on SEQRES records: (download)

>d1q3aa_ d.92.1.11 (A:) Stromelysin-2 (MMP-10) {Human (Homo sapiens) [TaxId: 9606]}
mpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfav
kehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslg
lfhsantealmyplynsftelaqfrlsqddvngiqslyg

Sequence, based on observed residues (ATOM records): (download)

>d1q3aa_ d.92.1.11 (A:) Stromelysin-2 (MMP-10) {Human (Homo sapiens) [TaxId: 9606]}
mpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfav
kehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslg
lfhsantealmyplynslaqfrlsqddvngiqslyg

SCOPe Domain Coordinates for d1q3aa_:

Click to download the PDB-style file with coordinates for d1q3aa_.
(The format of our PDB-style files is described here.)

Timeline for d1q3aa_: