Lineage for d1q3aa_ (1q3a A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415443Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 415444Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 415641Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 415792Protein Stromelysin-2 (MMP-10) [103128] (1 species)
  7. 415793Species Human (Homo sapiens) [TaxId:9606] [103129] (1 PDB entry)
  8. 415794Domain d1q3aa_: 1q3a A: [95664]

Details for d1q3aa_

PDB Entry: 1q3a (more details), 2.1 Å

PDB Description: crystal structure of the catalytic domain of human matrix metalloproteinase 10

SCOP Domain Sequences for d1q3aa_:

Sequence, based on SEQRES records: (download)

>d1q3aa_ d.92.1.11 (A:) Stromelysin-2 (MMP-10) {Human (Homo sapiens)}
mpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfav
kehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslg
lfhsantealmyplynsftelaqfrlsqddvngiqslyg

Sequence, based on observed residues (ATOM records): (download)

>d1q3aa_ d.92.1.11 (A:) Stromelysin-2 (MMP-10) {Human (Homo sapiens)}
mpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfav
kehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslg
lfhsantealmyplynslaqfrlsqddvngiqslyg

SCOP Domain Coordinates for d1q3aa_:

Click to download the PDB-style file with coordinates for d1q3aa_.
(The format of our PDB-style files is described here.)

Timeline for d1q3aa_: