Lineage for d1q35a_ (1q35 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144460Protein Ferric-binding protein FbpA [53867] (7 species)
  7. 2144480Species Mannheimia haemolytica [TaxId:75985] [102691] (3 PDB entries)
    Uniprot Q9Z4N6
  8. 2144481Domain d1q35a_: 1q35 A: [95661]
    complexed with edo, fmt

Details for d1q35a_

PDB Entry: 1q35 (more details), 1.2 Å

PDB Description: Crystal Structure of Pasteurella haemolytica Apo Ferric ion-Binding Protein A
PDB Compounds: (A:) iron binding protein FbpA

SCOPe Domain Sequences for d1q35a_:

Sequence, based on SEQRES records: (download)

>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]}
anevnvysyrqpyliepmlknfekdtgikvniifadkglvdrvkqegelspadvlltvdi
srvmeivnadlaqkidskvleknipaqfrdsndqwfglttrarviytskdrvgklpagfd
yldlakpeykgkvcvrsgknsynvslfaamiehygiektkafleglkanlarkpqggdrd
qvkaikegicdysignsyyygkmlddekqkswaeaaiinfpsgehgthknisgvviakhs
pnkanavklieylsgekaqglyaelnheypvkegiepsaivkgwgtfksdtiklediakn
yeaalklvdevkfddfse

Sequence, based on observed residues (ATOM records): (download)

>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]}
anevnvysyrqpyliepmlknfekdtgikvniifadglvdrvkqegelspadvlltvdis
rvmeivnadlaqkidskvleknipaqfrdsndqwfglttrarviytskdrvgklpagfdy
ldlakpeykgkvcvrsgknsynvslfaamiehygiektkafleglkanlarkpqggdrdq
vkaikegicdysignsyyygkmlddekqkswaeaaiinfpsgehgthknisgvviakhsp
nkanavklieylsgekaqglyaelnheypvkegiepsaivkgwgtfksdtiklediakny
eaalklvdevkfddfse

SCOPe Domain Coordinates for d1q35a_:

Click to download the PDB-style file with coordinates for d1q35a_.
(The format of our PDB-style files is described here.)

Timeline for d1q35a_: