Lineage for d1q34c_ (1q34 C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1198735Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1198736Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1198737Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1198745Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1198866Species Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId:6239] [102842] (1 PDB entry)
  8. 1198869Domain d1q34c_: 1q34 C: [95660]

Details for d1q34c_

PDB Entry: 1q34 (more details), 2.9 Å

PDB Description: Crystal structures of two UBC (E2) enzymes of the ubiquitin-conjugating system in Caenorhabditis elegans
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2-21.5 kDa

SCOPe Domain Sequences for d1q34c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q34c_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]}
ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
anslaaqlyqenrreyekrvqqiveqswl

SCOPe Domain Coordinates for d1q34c_:

Click to download the PDB-style file with coordinates for d1q34c_.
(The format of our PDB-style files is described here.)

Timeline for d1q34c_: