Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (3 families) |
Family d.20.1.1: Ubiquitin conjugating enzyme, UBC [54496] (1 protein) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (18 species) |
Species Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId:6239] [102842] (1 PDB entry) |
Domain d1q34c_: 1q34 C: [95660] |
PDB Entry: 1q34 (more details), 2.9 Å
SCOP Domain Sequences for d1q34c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q34c_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa} ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp anslaaqlyqenrreyekrvqqiveqswl
Timeline for d1q34c_: