![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (2 families) ![]() |
![]() | Family d.20.1.1: Ubiquitin conjugating enzyme, UBC [54496] (1 protein) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (17 species) |
![]() | Species Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId:6239] [102842] (1 PDB entry) |
![]() | Domain d1q34c_: 1q34 C: [95660] |
PDB Entry: 1q34 (more details), 2.9 Å
SCOP Domain Sequences for d1q34c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q34c_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa} ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp anslaaqlyqenrreyekrvqqiveqswl
Timeline for d1q34c_: