Lineage for d1q34b_ (1q34 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1406955Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1407083Species Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId:6239] [102842] (1 PDB entry)
  8. 1407085Domain d1q34b_: 1q34 B: [95659]

Details for d1q34b_

PDB Entry: 1q34 (more details), 2.9 Å

PDB Description: Crystal structures of two UBC (E2) enzymes of the ubiquitin-conjugating system in Caenorhabditis elegans
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2-21.5 kDa

SCOPe Domain Sequences for d1q34b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q34b_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]}
ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
anslaaqlyqenrreyekrvqqiveqswl

SCOPe Domain Coordinates for d1q34b_:

Click to download the PDB-style file with coordinates for d1q34b_.
(The format of our PDB-style files is described here.)

Timeline for d1q34b_: