Lineage for d1q34b_ (1q34 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501596Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 501597Superfamily d.20.1: UBC-like [54495] (3 families) (S)
  5. 501598Family d.20.1.1: Ubiquitin conjugating enzyme, UBC [54496] (1 protein)
  6. 501599Protein Ubiquitin conjugating enzyme, UBC [54497] (17 species)
  7. 501646Species Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId:6239] [102842] (1 PDB entry)
  8. 501648Domain d1q34b_: 1q34 B: [95659]

Details for d1q34b_

PDB Entry: 1q34 (more details), 2.9 Å

PDB Description: Crystal structures of two UBC (E2) enzymes of the ubiquitin-conjugating system in Caenorhabditis elegans

SCOP Domain Sequences for d1q34b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q34b_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa}
ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
anslaaqlyqenrreyekrvqqiveqswl

SCOP Domain Coordinates for d1q34b_:

Click to download the PDB-style file with coordinates for d1q34b_.
(The format of our PDB-style files is described here.)

Timeline for d1q34b_: