Lineage for d1q34a_ (1q34 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546255Species Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId:6239] [102842] (1 PDB entry)
  8. 2546256Domain d1q34a_: 1q34 A: [95658]

Details for d1q34a_

PDB Entry: 1q34 (more details), 2.9 Å

PDB Description: Crystal structures of two UBC (E2) enzymes of the ubiquitin-conjugating system in Caenorhabditis elegans
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-21.5 kDa

SCOPe Domain Sequences for d1q34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q34a_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]}
ttpsrrrlmrdfkklqedppagvsgaptedniltweaiifgpqetpfedgtfklslefte
eypnkpptvkfiskmfhpnvyadgsicldilqnrwsptydvaailtsiqslldepnpnsp
anslaaqlyqenrreyekrvqqiveqswl

SCOPe Domain Coordinates for d1q34a_:

Click to download the PDB-style file with coordinates for d1q34a_.
(The format of our PDB-style files is described here.)

Timeline for d1q34a_: