Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.19: C-terminal domain of Ku80 [101420] (1 family) automatically mapped to Pfam PF08785 |
Family a.118.19.1: C-terminal domain of Ku80 [101421] (1 protein) |
Protein C-terminal domain of Ku80 [101422] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101423] (2 PDB entries) |
Domain d1q2za_: 1q2z A: [95656] |
PDB Entry: 1q2z (more details)
SCOPe Domain Sequences for d1q2za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q2za_ a.118.19.1 (A:) C-terminal domain of Ku80 {Human (Homo sapiens) [TaxId: 9606]} gpvnpaenfrvlvkqkkasfeeasnqlinhieqfldtnetpyfmksidcirafreeaikf seeqrfnnflkalqekveikqlnhfweivvqdgitlitkeeasgssvtaeeakkflapkd
Timeline for d1q2za_: