Lineage for d1q2za_ (1q2z A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2011363Superfamily a.118.19: C-terminal domain of Ku80 [101420] (1 family) (S)
    automatically mapped to Pfam PF08785
  5. 2011364Family a.118.19.1: C-terminal domain of Ku80 [101421] (1 protein)
  6. 2011365Protein C-terminal domain of Ku80 [101422] (1 species)
  7. 2011366Species Human (Homo sapiens) [TaxId:9606] [101423] (2 PDB entries)
  8. 2011368Domain d1q2za_: 1q2z A: [95656]

Details for d1q2za_

PDB Entry: 1q2z (more details)

PDB Description: the 3d solution structure of the c-terminal region of ku86
PDB Compounds: (A:) ATP-dependent DNA helicase II, 80 kDa subunit

SCOPe Domain Sequences for d1q2za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2za_ a.118.19.1 (A:) C-terminal domain of Ku80 {Human (Homo sapiens) [TaxId: 9606]}
gpvnpaenfrvlvkqkkasfeeasnqlinhieqfldtnetpyfmksidcirafreeaikf
seeqrfnnflkalqekveikqlnhfweivvqdgitlitkeeasgssvtaeeakkflapkd

SCOPe Domain Coordinates for d1q2za_:

Click to download the PDB-style file with coordinates for d1q2za_.
(The format of our PDB-style files is described here.)

Timeline for d1q2za_: