![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (20 proteins) |
![]() | Protein Probable acetyltransferase YjcF [103169] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [103170] (1 PDB entry) |
![]() | Domain d1q2ya_: 1q2y A: [95655] structural genomics; NYSGRC target T804 |
PDB Entry: 1q2y (more details), 2 Å
SCOP Domain Sequences for d1q2ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis} mkaviakneeqlkdafyvreevfvkeqnvpaeeeidelenesehivvydgekpvgagrwr mkdgygklericvlkshrsagvggiimkalekaaadggasgfilnaqtqavpfykkhgyr vlsekefldagiphlqmmkd
Timeline for d1q2ya_: