Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein Probable acetyltransferase YjcF [103169] (1 species) |
Species Bacillus subtilis [TaxId:1423] [103170] (1 PDB entry) |
Domain d1q2ya_: 1q2y A: [95655] structural genomics; NYSGRC target T804 |
PDB Entry: 1q2y (more details), 2 Å
SCOPe Domain Sequences for d1q2ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} mkaviakneeqlkdafyvreevfvkeqnvpaeeeidelenesehivvydgekpvgagrwr mkdgygklericvlkshrsagvggiimkalekaaadggasgfilnaqtqavpfykkhgyr vlsekefldagiphlqmmkd
Timeline for d1q2ya_: