Lineage for d1q2ya_ (1q2y A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968637Protein Probable acetyltransferase YjcF [103169] (1 species)
  7. 2968638Species Bacillus subtilis [TaxId:1423] [103170] (1 PDB entry)
  8. 2968639Domain d1q2ya_: 1q2y A: [95655]
    structural genomics; NYSGRC target T804

Details for d1q2ya_

PDB Entry: 1q2y (more details), 2 Å

PDB Description: crystal structure of the protein yjcf from bacillus subtilis: a member of the gcn5-related n-acetyltransferase superfamily fold
PDB Compounds: (A:) similar to hypothetical proteins

SCOPe Domain Sequences for d1q2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]}
mkaviakneeqlkdafyvreevfvkeqnvpaeeeidelenesehivvydgekpvgagrwr
mkdgygklericvlkshrsagvggiimkalekaaadggasgfilnaqtqavpfykkhgyr
vlsekefldagiphlqmmkd

SCOPe Domain Coordinates for d1q2ya_:

Click to download the PDB-style file with coordinates for d1q2ya_.
(The format of our PDB-style files is described here.)

Timeline for d1q2ya_: