Lineage for d1q2vd1 (1q2v D:9-145,D:406-526)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345324Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 2345325Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 2345509Family a.129.1.2: Group II chaperonin (CCT, TRIC), ATPase domain [48596] (1 protein)
  6. 2345510Protein Thermosome, E domain [48597] (3 species)
  7. 2345511Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [101457] (4 PDB entries)
  8. 2345523Domain d1q2vd1: 1q2v D:9-145,D:406-526 [95652]
    Other proteins in same PDB: d1q2va2, d1q2va3, d1q2vb2, d1q2vb3, d1q2vc2, d1q2vc3, d1q2vd2, d1q2vd3
    complexed with so4

Details for d1q2vd1

PDB Entry: 1q2v (more details), 2.4 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (nucleotide-free form)
PDB Compounds: (D:) Thermosome alpha subunit

SCOPe Domain Sequences for d1q2vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2vd1 a.129.1.2 (D:9-145,D:406-526) Thermosome, E domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]}
vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati
ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy
alaaekaqeildeiairXavlpaggapeielairldeyakqvggkealaienfadalkii
pktlaenagldtvemlvkvisehknrglgigidvfegkpadmlekgiieplrvkkqaiks
aseaaimilriddviaaka

SCOPe Domain Coordinates for d1q2vd1:

Click to download the PDB-style file with coordinates for d1q2vd1.
(The format of our PDB-style files is described here.)

Timeline for d1q2vd1: