![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily) multihelical; 8 helices arranged in 2 parallel layers |
![]() | Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) ![]() duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site |
![]() | Family a.129.1.2: Group II chaperonin (CCT, TRIC), ATPase domain [48596] (1 protein) |
![]() | Protein Thermosome, E domain [48597] (3 species) |
![]() | Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [101457] (4 PDB entries) |
![]() | Domain d1q2vd1: 1q2v D:9-145,D:406-526 [95652] Other proteins in same PDB: d1q2va2, d1q2va3, d1q2vb2, d1q2vb3, d1q2vc2, d1q2vc3, d1q2vd2, d1q2vd3 complexed with so4 |
PDB Entry: 1q2v (more details), 2.4 Å
SCOPe Domain Sequences for d1q2vd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q2vd1 a.129.1.2 (D:9-145,D:406-526) Thermosome, E domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} vvilpegtqryvgrdaqrlnilaariiaetvrttlgpkgmdkmlvdslgdivvtndcati ldkidlqhpaakmmvevaktqdkeagdgtttavviagellrkaeelldqnihpsiitkgy alaaekaqeildeiairXavlpaggapeielairldeyakqvggkealaienfadalkii pktlaenagldtvemlvkvisehknrglgigidvfegkpadmlekgiieplrvkkqaiks aseaaimilriddviaaka
Timeline for d1q2vd1: