![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) ![]() |
![]() | Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein) |
![]() | Protein Thermosome, A-domain [52035] (4 species) |
![]() | Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102202] (4 PDB entries) |
![]() | Domain d1q2vc2: 1q2v C:217-369 [95650] Other proteins in same PDB: d1q2va1, d1q2va3, d1q2vb1, d1q2vb3, d1q2vc1, d1q2vc3, d1q2vd1, d1q2vd3 complexed with so4 |
PDB Entry: 1q2v (more details), 2.4 Å
SCOPe Domain Sequences for d1q2vc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q2vc2 c.8.5.2 (C:217-369) Thermosome, A-domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} rgvvidkevvhprmpkrvenakialinealevkktetdakinitspdqlmsfleqeekml kdmvdhiaqtganvvfvqkgiddlaqhylakygimavrrvkksdmeklakatgakivtnv kdltpedlgyaevveerklagenmifvegcknp
Timeline for d1q2vc2: