Lineage for d1q2va3 (1q2v A:146-216,A:370-405)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411723Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 411724Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 411842Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein)
  6. 411843Protein Thermosome, I domain [54854] (3 species)
  7. 411844Species Archaeon Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102951] (4 PDB entries)
  8. 411849Domain d1q2va3: 1q2v A:146-216,A:370-405 [95645]
    Other proteins in same PDB: d1q2va1, d1q2va2, d1q2vb1, d1q2vb2, d1q2vc1, d1q2vc2, d1q2vd1, d1q2vd2

Details for d1q2va3

PDB Entry: 1q2v (more details), 2.4 Å

PDB Description: crystal structure of the chaperonin from thermococcus strain ks-1 (nucleotide-free form)

SCOP Domain Sequences for d1q2va3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2va3 d.56.1.2 (A:146-216,A:370-405) Thermosome, I domain {Archaeon Thermococcus sp. ks-1, alpha chain}
vdpddeetllkiaatsitgknaeshkellaklaveavkqvaekkdgkyvvdldnikfekk
agegveeselvXkavtilirggtehvideveraledavkvvkdvmedg

SCOP Domain Coordinates for d1q2va3:

Click to download the PDB-style file with coordinates for d1q2va3.
(The format of our PDB-style files is described here.)

Timeline for d1q2va3: