Lineage for d1q2sa_ (1q2s A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386841Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 386842Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 386853Protein Queosine tRNA-guanine transglycosylase [51715] (1 species)
    contains zinc-binding subdomain
  7. 386854Species Zymomonas mobilis [TaxId:542] [51716] (23 PDB entries)
  8. 386876Domain d1q2sa_: 1q2s A: [95638]

Details for d1q2sa_

PDB Entry: 1q2s (more details), 3.2 Å

PDB Description: chemical trapping and crystal structure of a catalytic trna guanine transglycosylase covalent intermediate

SCOP Domain Sequences for d1q2sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2sa_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryfarns

SCOP Domain Coordinates for d1q2sa_:

Click to download the PDB-style file with coordinates for d1q2sa_.
(The format of our PDB-style files is described here.)

Timeline for d1q2sa_: