SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1q2sa_ (1q2s A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089551Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2089552Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 protein domains)
  6. 2089563Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2089589Species Zymomonas mobilis [TaxId:542] [51716] (94 PDB entries)
    Uniprot P28720
  8. 2089685Domain d1q2sa_: 1q2s A: [95638]
    protein/RNA complex; complexed with 9dg, zn

Details for d1q2sa_

PDB Entry: 1q2s (more details), 3.2 Å

PDB Description: Chemical trapping and crystal structure of a catalytic tRNA guanine transglycosylase covalent intermediate
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d1q2sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2sa_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryfarns

SCOPe Domain Coordinates for d1q2sa_:

Click to download the PDB-style file with coordinates for d1q2sa_.
(The format of our PDB-style files is described here.)

Timeline for d1q2sa_: