Lineage for d1q2ea_ (1q2e A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371784Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (1 protein)
    contains many insertions in the common fold
  6. 371785Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (5 species)
  7. 371812Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (11 PDB entries)
  8. 371819Domain d1q2ea_: 1q2e A: [95625]

Details for d1q2ea_

PDB Entry: 1q2e (more details), 1.75 Å

PDB Description: cellobiohydrolase cel7a with loop deletion 245-252 and bound non- hydrolysable cellotetraose

SCOP Domain Sequences for d1q2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2ea_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
dgcgggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgainryyvqng
vtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggmvlvmslwd
dyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsnikfgpigs
tgnpsg

SCOP Domain Coordinates for d1q2ea_:

Click to download the PDB-style file with coordinates for d1q2ea_.
(The format of our PDB-style files is described here.)

Timeline for d1q2ea_: