Lineage for d1q20a_ (1q20 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393658Family c.37.1.5: PAPS sulfotransferase [52575] (10 proteins)
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 393665Protein Cholesterol sulfotransferase sult2b1b [102350] (1 species)
  7. 393666Species Human (Homo sapiens) [TaxId:9606] [102351] (3 PDB entries)
    cytosolic enzyme
  8. 393667Domain d1q20a_: 1q20 A: [95616]
    complexed with a3p, na, plo

Details for d1q20a_

PDB Entry: 1q20 (more details), 2.3 Å

PDB Description: crystal structure of human cholesterol sulfotransferase (sult2b1b) in the presence of pap and pregnenolone

SCOP Domain Sequences for d1q20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q20a_ c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1b {Human (Homo sapiens)}
sdiseisqklpgeyfrykgvpfpvglyslesislaentqdvrdddifiitypksgttwmi
eiiclilkegdpswirsvpiwerapwcetivgafslpdqysprlmsshlpiqiftkaffs
skakviymgrnprdvvvslyhyskiagqlkdpgtpdqflrdflkgevqfgswfdhikgwl
rmkgkdnflfityeelqqdlqgsvericgflgrplgkealgsvvahstfsamkantmsny
tllppslldhrrgaflrkgvcgdwknhftvaqseafdrayrkqmrgmptfpwde

SCOP Domain Coordinates for d1q20a_:

Click to download the PDB-style file with coordinates for d1q20a_.
(The format of our PDB-style files is described here.)

Timeline for d1q20a_: