Lineage for d1q1za_ (1q1z A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109910Protein Cholesterol sulfotransferase sult2b1b [102350] (1 species)
  7. 2109911Species Human (Homo sapiens) [TaxId:9606] [102351] (3 PDB entries)
    cytosolic enzyme
  8. 2109913Domain d1q1za_: 1q1z A: [95615]
    complexed with a3p, na

Details for d1q1za_

PDB Entry: 1q1z (more details), 2.4 Å

PDB Description: crystal structure of human cholesterol sulfotransferase (sult2b1b) in the presence of pap
PDB Compounds: (A:) sulfotransferase family, cytosolic, 2B, member 1 isoform b

SCOPe Domain Sequences for d1q1za_:

Sequence, based on SEQRES records: (download)

>d1q1za_ c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1b {Human (Homo sapiens) [TaxId: 9606]}
klpgeyfrykgvpfpvglyslesislaentqdvrdddifiitypksgttwmieiiclilk
egdpswirsvpiwerapwcetivgafslpdqysprlmsshlpiqiftkaffsskakviym
grnprdvvvslyhyskiagqlkdpgtpdqflrdflkgevqfgswfdhikgwlrmkgkdnf
lfityeelqqdlqgsvericgflgrplgkealgsvvahstfsamkantmsnytllppsll
dhrrgaflrkgvcgdwknhftvaqseafdrayrkqmrgmptfpwde

Sequence, based on observed residues (ATOM records): (download)

>d1q1za_ c.37.1.5 (A:) Cholesterol sulfotransferase sult2b1b {Human (Homo sapiens) [TaxId: 9606]}
klpgeyfrykgvpfpvglyslesislaentqdvrdddifiitypksgttwmieiiclilk
egdpswirsvpiwerapwcetivgafslpdsprlmsshlpiqiftkaffsskakviymgr
nprdvvvslyhyskiagqlkdpgtpdqflrdflkgevqfgswfdhikgwlrmkgkdnflf
ityeelqqdlqgsvericgflgrplgkealgsvvahstfsamkantmsnytllppslldh
rrgaflrkgvcgdwknhftvaqseafdrayrkqmrgmptfpwde

SCOPe Domain Coordinates for d1q1za_:

Click to download the PDB-style file with coordinates for d1q1za_.
(The format of our PDB-style files is described here.)

Timeline for d1q1za_: