Lineage for d1q1wb3 (1q1w B:320-423)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916781Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 1916782Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 1916783Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 1916908Protein Putidaredoxin reductase [103115] (1 species)
  7. 1916909Species Pseudomonas putida [TaxId:303] [103116] (2 PDB entries)
  8. 1916913Domain d1q1wb3: 1q1w B:320-423 [95614]
    Other proteins in same PDB: d1q1wa1, d1q1wa2, d1q1wb1, d1q1wb2
    complexed with fad

Details for d1q1wb3

PDB Entry: 1q1w (more details), 2.6 Å

PDB Description: Crystal Structure of Putidaredoxin Reductase from Pseudomonas putida
PDB Compounds: (B:) Putidaredoxin reductase

SCOPe Domain Sequences for d1q1wb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1wb3 d.87.1.1 (B:320-423) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}
vprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpdfsvfylqgdrvlavdtvnr
pvefnqskqiitdrlpvepnllgdesvplkeiiaaakaelssap

SCOPe Domain Coordinates for d1q1wb3:

Click to download the PDB-style file with coordinates for d1q1wb3.
(The format of our PDB-style files is described here.)

Timeline for d1q1wb3: