![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.1: Cytokine [50353] (2 families) ![]() |
![]() | Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins) |
![]() | Protein Fibrobast growth factor homologous factor 1 (FHF1b, FGF12b) [101776] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101777] (1 PDB entry) |
![]() | Domain d1q1ua_: 1q1u A: [95608] |
PDB Entry: 1q1u (more details), 1.7 Å
SCOP Domain Sequences for d1q1ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1ua_ b.42.1.1 (A:) Fibrobast growth factor homologous factor 1 (FHF1b, FGF12b) {Human (Homo sapiens)} pqlkgivtrlfsqqgyflqmhpdgtidgtkdensdytlfnlipvglrvvaiqgvkaslyv amngegylyssdvftpeckfkesvfenyyviysstlyrqqesgrawflglnkegqimkgn rvkktkpsshfvpkpiev
Timeline for d1q1ua_: