Lineage for d1q1ua_ (1q1u A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464259Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 464260Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)
  6. 464369Protein Fibrobast growth factor homologous factor 1 (FHF1b, FGF12b) [101776] (1 species)
  7. 464370Species Human (Homo sapiens) [TaxId:9606] [101777] (1 PDB entry)
  8. 464371Domain d1q1ua_: 1q1u A: [95608]

Details for d1q1ua_

PDB Entry: 1q1u (more details), 1.7 Å

PDB Description: crystal structure of human fhf1b (fgf12b)

SCOP Domain Sequences for d1q1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1ua_ b.42.1.1 (A:) Fibrobast growth factor homologous factor 1 (FHF1b, FGF12b) {Human (Homo sapiens)}
pqlkgivtrlfsqqgyflqmhpdgtidgtkdensdytlfnlipvglrvvaiqgvkaslyv
amngegylyssdvftpeckfkesvfenyyviysstlyrqqesgrawflglnkegqimkgn
rvkktkpsshfvpkpiev

SCOP Domain Coordinates for d1q1ua_:

Click to download the PDB-style file with coordinates for d1q1ua_.
(The format of our PDB-style files is described here.)

Timeline for d1q1ua_: