Lineage for d1q1rb2 (1q1r B:115-247)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109874Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2110132Protein Putidaredoxin reductase [102185] (1 species)
  7. 2110133Species Pseudomonas putida [TaxId:303] [102186] (2 PDB entries)
  8. 2110137Domain d1q1rb2: 1q1r B:115-247 [95604]
    Other proteins in same PDB: d1q1ra3, d1q1rb3
    complexed with fad

Details for d1q1rb2

PDB Entry: 1q1r (more details), 1.91 Å

PDB Description: Crystal Structure of Putidaredoxin Reductase from Pseudomonas putida
PDB Compounds: (B:) Putidaredoxin reductase

SCOPe Domain Sequences for d1q1rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1rb2 c.3.1.5 (B:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}
rplpvasgavgkannfrylrtledaecirrqliadnrlvvigggyiglevaataikanmh
vtlldtaarvlervtappvsafyehlhreagvdirtgtqvcgfemstdqqkvtavlcedg
trlpadlviagig

SCOPe Domain Coordinates for d1q1rb2:

Click to download the PDB-style file with coordinates for d1q1rb2.
(The format of our PDB-style files is described here.)

Timeline for d1q1rb2: