![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (13 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Putidaredoxin reductase [102185] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [102186] (2 PDB entries) |
![]() | Domain d1q1rb1: 1q1r B:2-114,B:248-319 [95603] Other proteins in same PDB: d1q1ra3, d1q1rb3 |
PDB Entry: 1q1r (more details), 1.91 Å
SCOP Domain Sequences for d1q1rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1rb1 c.3.1.5 (B:2-114,B:248-319) Putidaredoxin reductase {Pseudomonas putida} nandnvvivgtglagvevafglrasgwegnirlvgdatviphhlpplskaylagkataes lylrtpdayaaqniqllggtqvtainrdrqqvilsdgraldydrlvlatggrpXlipnce lasaaglqvdngivinehmqtsdplimavgdcarfhsqlydrwvriesvpnaleqarkia ailcgk
Timeline for d1q1rb1: