Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
Protein Putidaredoxin reductase [103115] (1 species) |
Species Pseudomonas putida [TaxId:303] [103116] (2 PDB entries) |
Domain d1q1ra3: 1q1r A:320-422 [95602] Other proteins in same PDB: d1q1ra1, d1q1ra2, d1q1rb1, d1q1rb2 complexed with fad |
PDB Entry: 1q1r (more details), 1.91 Å
SCOPe Domain Sequences for d1q1ra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1ra3 d.87.1.1 (A:320-422) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} vprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpdfsvfylqgdrvlavdtvnr pvefnqskqiitdrlpvepnllgdesvplkeiiaaakaelssa
Timeline for d1q1ra3: